TA337252 KLHL36 antibody

Rabbit Polyclonal Anti-KLHL36 Antibody

See related secondary antibodies

Search for all "KLHL36"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish KLHL36

Product Description for KLHL36

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish KLHL36.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KLHL36

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C16orf44, Kelch-like protein 36
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4N3
Immunogen:
The immunogen for anti-C16ORF44 antibody: synthetic peptide directed towards the N terminal of human C16ORF44. Synthetic peptide located within the following region: FCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPD.
GeneID:
79786
Application WB
Background C16orf44 is an open reading frame 44, found in chromosome 16
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KLHL36 (4 products)

Catalog No. Species Pres. Purity   Source  

KLHL36

KLHL36 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KLHL36

KLHL36 Human Purified
  Abnova Taiwan Corp.

KLHL36

KLHL36 Human
  Abnova Taiwan Corp.

KLHL36

KLHL36 Human Purified
  Abnova Taiwan Corp.

Positive controls for KLHL36 (2 products)

Catalog No. Species Pres. Purity   Source  

C16orf44 293T Cell Transient Overexpression Lysate(Denatured)

C16orf44 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

KLHL36 overexpression lysate

KLHL36 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn