TA337254 UHRF2 antibody

Rabbit Polyclonal Anti-UHRF2 Antibody

See related secondary antibodies

Search for all "UHRF2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish UHRF2

Product Description for UHRF2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish UHRF2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UHRF2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase UHRF2, NIRF, Np95/ICBP90-like RING finger protein, Nuclear zinc finger protein Np97, RING finger protein 107, RNF107, Ubiquitin-like PHD and RING finger domain-containing protein 2, Ubiquitin-like-containing PHD and RING finger domains protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PU4
Immunogen:
The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the middle region of human UHRF2. Synthetic peptide located within the following region: NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYK.
GeneID:
115426
Application WB
Background UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquiting PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquiting PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UHRF2 (5 products)

Catalog No. Species Pres. Purity   Source  

UHRF2

UHRF2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UHRF2

UHRF2 Human Purified
  Abnova Taiwan Corp.

UHRF2

UHRF2 Human Purified
  Abnova Taiwan Corp.

UHRF2

UHRF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UHRF2

UHRF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UHRF2 (3 products)

Catalog No. Species Pres. Purity   Source  

NIRF Lysate

Western Blot: NIRF Lysate [NBL1-17604] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UHRF2
  Novus Biologicals Inc.

UHRF2 293T Cell Transient Overexpression Lysate(Denatured)

UHRF2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

UHRF2 overexpression lysate

UHRF2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn