TA337258 TRIM8 / GERP / RNF27 antibody

Rabbit Polyclonal Anti-TRIM8 Antibody

See related secondary antibodies

Search for all "TRIM8 / GERP / RNF27"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRIM8 / GERP / RNF27

Product Description for TRIM8 / GERP / RNF27

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRIM8 / GERP / RNF27.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM8 / GERP / RNF27

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Glioblastoma-expressed RING finger protein, RING finger protein 27, Tripartite motif-containing protein 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZR9
Immunogen:
The immunogen for anti-TRIM8 antibody: synthetic peptide directed towards the middle region of human TRIM8. Synthetic peptide located within the following region: QSVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGE.
GeneID:
81603
Application WB
Background This protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to nuclear bodies. Its structure is similar to some tumor suppressor proteins and its gene maps to a locus thought to contain tumor suppressor genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to nuclear bodies. Its structure is similar to some tumor suppressor proteins and its gene maps to a locus thought to contain tumor suppressor genes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM8 / GERP / RNF27 (3 products)

Catalog No. Species Pres. Purity   Source  

TRIM8 / GERP / RNF27

TRIM8 / GERP / RNF27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRIM8 / GERP / RNF27

TRIM8 / GERP / RNF27 Human Purified
  Abnova Taiwan Corp.

TRIM8 / GERP / RNF27

TRIM8 / GERP / RNF27 Human Purified
  Abnova Taiwan Corp.

Positive controls for TRIM8 / GERP / RNF27 (1 products)

Catalog No. Species Pres. Purity   Source  

TRIM8 293T Cell Transient Overexpression Lysate(Denatured)

TRIM8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn