TA337260 LAS1L antibody

Rabbit Polyclonal Anti-LAS1L Antibody

See related secondary antibodies

Search for all "LAS1L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human LAS1L

TA337260

More Views

  • TA337260
  • TA337260
  • TA337260
  • TA337260
  • TA337260
  • TA337260
  • TA337260
  • TA337260

Product Description for LAS1L

Rabbit anti Bovine, Equine, Human LAS1L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LAS1L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LAS1-like protein
Presentation Purified
Reactivity Bov, Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y4W2
Immunogen:
The immunogen for Anti-LAS1L antibody is: synthetic peptide directed towards the middle region of Human LAS1L. Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE.
GeneID:
81887
Application WB
Background The function of LAS1L has not been determined.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LAS1L (2 products)

Catalog No. Species Pres. Purity   Source  

LAS1L

LAS1L Human Purified
  Abnova Taiwan Corp.

LAS1L

LAS1L Human Purified
  Abnova Taiwan Corp.

Positive controls for LAS1L (2 products)

Catalog No. Species Pres. Purity   Source  

LAS1L 293T Cell Transient Overexpression Lysate(Denatured)

LAS1L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LAS1L overexpression lysate

LAS1L overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn