RNF135

Product Description for RNF135

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat RNF135.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	E3 ubiquitin-protein ligase RNF135, REUL, RIG-I E3 ubiquitin ligase, RING finger protein 135, Riplet
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Hu, Ms, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q8IUD6 Immunogen: The immunogen for anti-RNF135 antibody: synthetic peptide directed towards the middle region of human RNF135. Synthetic peptide located within the following region: DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL. GeneID: 84282
Application	WB
Background	The protein encoded by RNF135 contains a RING finger domain, a motif present in a variety of functiolly distinct proteins and known to be involved in protein-protein and protein-D interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis.
Format	Purification: Affinity Purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Pres.	Purity	Source
TP319438	RNF135 (transcript variant 1)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP329833	RNF135 (transcript variant 3)
	Human		> 80 % Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00084282-P01-10	RNF135
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00084282-P01-25	RNF135
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.

Catalog No.	Species
H00084282-T01	RNF135 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
LY410198	RNF135 overexpression lysate
		0.1 mg / €495.00
		OriGene Technologies, Inc.
LY432833	RNF135 overexpression lysate
		0.1 mg / €315.00
		OriGene Technologies, Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH