TA337269 PSIP1 antibody

Rabbit Polyclonal Anti-PSIP1 Antibody

See related secondary antibodies

Search for all "PSIP1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep PSIP1

TA337269

More Views

  • TA337269
  • TA337269

Product Description for PSIP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep PSIP1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for PSIP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CLL-associated antigen KW-7, DFS 70, DFS70, Dense fine speckles 70 kDa protein, LEDGF, Lens epithelium-derived growth factor, PC4 and SFRS1-interacting protein, PSIP1, PSIP2, Transcriptional coactivator p75/p52
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Sh
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75475
Immunogen:
The immunogen for anti-PSIP1 antibody: synthetic peptide directed towards the middle region of human PSIP1. Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK.
GeneID:
11168
Application WB
IHC
Background PSIP1 is a transcriptiol coactivator. It also acts as an adaptor to coordite pre-mR splicing and transcriptiol activation of class II genes.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PSIP1 (2 products)

Catalog No. Species Pres. Purity   Source  

PSIP1

PSIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PSIP1

PSIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn