TA337293 RNF41 antibody

Rabbit Polyclonal Anti-RNF41 Antibody

See related secondary antibodies

Search for all "RNF41"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RNF41

Product Description for RNF41

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RNF41.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF41

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase NRDP1, FLRF, NRDP1, RING finger protein 41
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H4P4
Immunogen:
The immunogen for anti-RNF41 antibody: synthetic peptide directed towards the middle region of human RNF41. Synthetic peptide located within the following region: QQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETI.
GeneID:
10193
Application WB
Background RNF41 contains a RING finger, a motif present in a variety of functiolly distinct proteins and known to be involved in protein-protein and protein-D interactions. The specific function of this protein has not yet been determined. The protein encoded by this gene contains a RING finger, a motif present in a variety of functiolly distinct proteins and known to be involved in protein-protein and protein-D interactions. The specific function of this protein has not yet been determined. Three altertively spliced transcript variants encoding two distinct isoforms have been reported.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF41 (6 products)

Catalog No. Species Pres. Purity   Source  

RNF41 (transcript variant 2)

RNF41 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RNF41 (full length, N-term HIS tag, transcript variant 3)

RNF41 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

RNF41

RNF41 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF41

RNF41 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF41

RNF41 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RNF41

RNF41 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RNF41 (3 products)

Catalog No. Species Pres. Purity   Source  

RNF41 293T Cell Transient Overexpression Lysate(Denatured)

RNF41 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RNF41 Lysate

Western Blot: RNF41 Lysate [NBL1-15456] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RNF41
  Novus Biologicals Inc.

RNF41 overexpression lysate

RNF41 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn