TA337296 TRIM27 / RFP / RNF76 antibody

Rabbit Polyclonal Anti-TRIM27 Antibody

See related secondary antibodies

Search for all "TRIM27 / RFP / RNF76"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRIM27 / RFP / RNF76

Product Description for TRIM27 / RFP / RNF76

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRIM27 / RFP / RNF76.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM27 / RFP / RNF76

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RING finger protein 76, Tripartite motif-containing protein 27, Zinc finger protein RFP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P14373
Immunogen:
The immunogen for anti-TRIM27 antibody: synthetic peptide directed towards the middle region of human TRIM27. Synthetic peptide located within the following region: EQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLY.
GeneID:
5987
Application WB
Background TRIM27 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nuclear matrix. It interacts with the enhancer of polycomb protein and represses gene transcription. It is also thought to be involved in the differentiation of male germ cells. Fusion of the N-terminus of this protein with the truncated C-terminus of the RET gene product has been shown to result in production of the ret transforming protein.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM27 / RFP / RNF76 (1 products)

Catalog No. Species Pres. Purity   Source  

TRIM27 / RFP / RNF76 (full length, N-term HIS tag)

TRIM27 / RFP / RNF76 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for TRIM27 / RFP / RNF76 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM27 Lysate

Western Blot: TRIM27 Lysate [NBL1-17287] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRIM27
  Novus Biologicals Inc.

TRIM27 overexpression lysate

TRIM27 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn