TA337299 ZMYND11 antibody

Rabbit Polyclonal Anti-ZMYND11 Antibody

See related secondary antibodies

Search for all "ZMYND11"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZMYND11

TA337299

More Views

  • TA337299
  • TA337299

Product Description for ZMYND11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZMYND11.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZMYND11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Adenovirus 5 E1A-binding protein, BS69, Zinc finger MYND domain-containing protein 11
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15326
Immunogen:
The immunogen for anti-ZMYND11 antibody: synthetic peptide directed towards the N terminal of human ZMYND11. Synthetic peptide located within the following region: KKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNT.
GeneID:
10771
Application WB
IHC
Background ZMYND11 was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptiol repressor, and expression of E1A inhibits this repression.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZMYND11 (2 products)

Catalog No. Species Pres. Purity   Source  

ZMYND11

ZMYND11 Human Purified
  Abnova Taiwan Corp.

ZMYND11

ZMYND11 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZMYND11 (3 products)

Catalog No. Species Pres. Purity   Source  

ZMYND11 293T Cell Transient Overexpression Lysate(Denatured)

ZMYND11 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZMYND11 Lysate

Western Blot: ZMYND11 Lysate [NBL1-18049] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZMYND11.
  Novus Biologicals Inc.

ZMYND11 overexpression lysate

ZMYND11 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn