TA337303 NCS1 antibody

Rabbit Polyclonal Anti-FREQ Antibody

See related secondary antibodies

Search for all "NCS1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Yeast, Zebrafish NCS1

Product Description for NCS1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Yeast, Zebrafish NCS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NCS1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLUP, FREQ, NCS-1, Neuronal calcium sensor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62166
Immunogen:
The immunogen for anti-FREQ antibody: synthetic peptide directed towards the middle region of human FREQ. Synthetic peptide located within the following region: EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGL.
GeneID:
23413
Application WB
Background This gene is a member of the neurol calcium sensor gene family, which encode calcium-binding proteins expressed predomintly in neurons. The protein encoded by this gene regulates G protein-coupled receptor phosphorylation in a calcium-dependent manner
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NCS1 (6 products)

Catalog No. Species Pres. Purity   Source  

NCS1 (transcript variant 1)

NCS1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NCS1 (1-190, His-tag)

NCS1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €720.00
  OriGene Technologies GmbH

NCS1 (1-190, His-tag)

NCS1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €290.00
  OriGene Technologies GmbH

NCS1 (1-190, His-tag)

NCS1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

NCS1 (1-190, His-tag)

NCS1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

NCS1

SDS-Page: Frequenin Protein [NBP1-44484] - NCS1, 22.9 kDa (198aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Human Purified
  Novus Biologicals Inc.

Positive controls for NCS1 (3 products)

Catalog No. Species Pres. Purity   Source  

FREQ 293T Cell Transient Overexpression Lysate(Denatured)

FREQ 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Frequenin Lysate

Western Blot: Frequenin Lysate [NBL1-10831] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NCS1
  Novus Biologicals Inc.

NCS1 overexpression lysate

NCS1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn