TA337326 GOLPH3L antibody

Rabbit Polyclonal Anti-GOLPH3L Antibody

See related secondary antibodies

Search for all "GOLPH3L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat GOLPH3L

Product Description for GOLPH3L

Rabbit anti Human, Mouse, Rat GOLPH3L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GOLPH3L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GPP34R, Golgi phosphoprotein 3-like
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H4A5
Immunogen:
The immunogen for Anti-GOLPH3L antibody is: synthetic peptide directed towards the N-terminal region of Human GOLPH3L. Synthetic peptide located within the following region: EISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKE.
GeneID:
55204
Application WB
Background The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GOLPH3L (3 products)

Catalog No. Species Pres. Purity   Source  

GOLPH3L

GOLPH3L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GOLPH3L

GOLPH3L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GOLPH3L

GOLPH3L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GOLPH3L (1 products)

Catalog No. Species Pres. Purity   Source  

GOLPH3L Lysate

Western Blot: GOLPH3L Lysate [NBL1-11199] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GOLPH3L
  Novus Biologicals Inc.
  • LinkedIn