TA337335 GCS-alpha-2 / GUCY1A2 antibody

Rabbit Polyclonal Anti-GUCY1A2 Antibody

See related secondary antibodies

Search for all "GCS-alpha-2 / GUCY1A2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GCS-alpha-2 / GUCY1A2

Product Description for GCS-alpha-2 / GUCY1A2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GCS-alpha-2 / GUCY1A2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GCS-alpha-2 / GUCY1A2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GUC1A2, GUCSA2, Guanylate cyclase soluble subunit alpha-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P33402
Immunogen:
The immunogen for Anti-GUCY1A2 antibody is: synthetic peptide directed towards the N-terminal region of Human GUCY1A2. Synthetic peptide located within the following region: KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF.
GeneID:
2977
Application WB
Background Soluble guanylate cyclases are heterodimeric proteins that catalyze the conversion of GTP to 3',5'-cyclic GMP and pyrophosphate. The protein encoded by this gene is an alpha subunit of this complex and it interacts with a beta subunit to form the guanylate cyclase enzyme, which is activated by nitric oxide. Two transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GCS-alpha-2 / GUCY1A2 (4 products)

Catalog No. Species Pres. Purity   Source  

GCS-alpha-2 / GUCY1A2

GCS-alpha-2 / GUCY1A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GCS-alpha-2 / GUCY1A2

GCS-alpha-2 / GUCY1A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GCS-alpha-2 / GUCY1A2

GCS-alpha-2 / GUCY1A2 Human
  Abnova Taiwan Corp.

GCS-alpha-2 / GUCY1A2

GCS-alpha-2 / GUCY1A2 Human
  Abnova Taiwan Corp.

Positive controls for GCS-alpha-2 / GUCY1A2 (1 products)

Catalog No. Species Pres. Purity   Source  

GUCY1A2 overexpression lysate

GUCY1A2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn