TA337343 HENMT1 / C1orf59 antibody

Rabbit Polyclonal Anti-HENMT1 Antibody

See related secondary antibodies

Search for all "HENMT1 / C1orf59"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat HENMT1 / C1orf59

Product Description for HENMT1 / C1orf59

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat HENMT1 / C1orf59.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HENMT1 / C1orf59

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HEN1 methyltransferase homolog 1, LOC113802, Small RNA 2'-O-methyltransferase, UPF0486 protein C1orf59
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T8I9
Immunogen:
The immunogen for Anti-HENMT1 antibody is: synthetic peptide directed towards the N-terminal region of Human HENMT1. Synthetic peptide located within the following region: RETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPC.
GeneID:
113802
Application WB
Background HENMT1 is a methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRs, a class of 24 to 30 nucleotide Rs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRs from uridylation activity and subsequent degradation. Stabilization of piRs is essential for gametogenesis.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HENMT1 / C1orf59 (2 products)

Catalog No. Species Pres. Purity   Source  

HENMT1 / C1orf59 (transcript variant 1)

HENMT1 / C1orf59 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

HENMT1 / C1orf59 (transcript variant 2)

HENMT1 / C1orf59 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for HENMT1 / C1orf59 (4 products)

Catalog No. Species Pres. Purity   Source  

C1orf59 Lysate

Western Blot: C1orf59 Lysate [NBL1-08325] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf59 Protein
  Novus Biologicals Inc.

HENMT1 overexpression lysate

HENMT1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HENMT1 overexpression lysate

HENMT1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HENMT1 overexpression lysate

HENMT1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn