TA337351 IGSF9B antibody

Rabbit Polyclonal Anti-IGSF9B Antibody

See related secondary antibodies

Search for all "IGSF9B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish IGSF9B

Product Description for IGSF9B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish IGSF9B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IGSF9B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IgSF9B, Immunoglobulin superfamily member 9B, KIAA1030, Protein turtle homolog B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UPX0
Immunogen:
The immunogen for Anti-IGSF9B antibody is: synthetic peptide directed towards the middle region of Human IGSF9B. Synthetic peptide located within the following region: QDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGKYTCVPSNSLGRSPSA.
GeneID:
22997
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn