TA337357 INTS2 antibody

Rabbit Polyclonal Anti-INTS2 Antibody

See related secondary antibodies

Search for all "INTS2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish INTS2

Product Description for INTS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish INTS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for INTS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Integrator complex subunit 2, KIAA1287
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0H0
Immunogen:
The immunogen for Anti-INTS2 antibody is: synthetic peptide directed towards the N-terminal region of Human INTS2. Synthetic peptide located within the following region: VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL.
GeneID:
57508
Application WB
Background INTS2 is a subunit of the Integrator complex, which associates with the C-termil domain of R polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear Rs U1.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for INTS2 (1 products)

Catalog No. Species Pres. Purity   Source  

INTS2 overexpression lysate

INTS2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn