TA337360 INTS10 antibody

Rabbit Polyclonal Anti-INTS10 Antibody

See related secondary antibodies

Search for all "INTS10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish INTS10

Product Description for INTS10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish INTS10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for INTS10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C8orf35, Integrator complex subunit 10
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVR2
Immunogen:
The immunogen for Anti-INTS10 antibody is: synthetic peptide directed towards the N-terminal region of Human INTS10. Synthetic peptide located within the following region: NAERTATAGRLLYDMFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRS.
GeneID:
55174
Application WB
Background INTS10 is a subunit of the Integrator complex, which associates with the C-termil domain of R polymerase II large subunit and mediates 3-prime end processing of small nuclear Rs U1.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn