TA337370 KBTBD11 antibody

Rabbit Polyclonal Anti-KBTBD11 Antibody

See related secondary antibodies

Search for all "KBTBD11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human KBTBD11

Product Description for KBTBD11

Rabbit anti Human KBTBD11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KBTBD11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CMLAP, Chronic myelogenous leukemia-associated protein, KIAA0711, KLHDC7C, Kelch domain-containing protein 7B, Kelch repeat and BTB domain-containing protein 11
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94819
Immunogen:
The immunogen for Anti-KBTBD11 antibody is: synthetic peptide directed towards the C-terminal region of Human KBTBD11. Synthetic peptide located within the following region: GGPTGLQPFRCAALDGAIYCVSRAGTWRFQPAREGEAGGDAGQGGGFEAL.
GeneID:
9920
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KBTBD11 (1 products)

Catalog No. Species Pres. Purity   Source  

KBTBD11

KBTBD11 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for KBTBD11 (1 products)

Catalog No. Species Pres. Purity   Source  

KBTBD11 overexpression lysate

KBTBD11 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn