TA337378 KIAA0664 antibody

Rabbit Polyclonal Anti-CLUH Antibody

See related secondary antibodies

Search for all "KIAA0664"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KIAA0664

Product Description for KIAA0664

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KIAA0664.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA0664

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CLU1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75153
Immunogen:
The immunogen for Anti-CLUH antibody is: synthetic peptide directed towards the N-terminal region of Human CLUH. Synthetic peptide located within the following region: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW.
GeneID:
23277
Application WB
Background CLUH is involved in proper cytoplasmic distribution of mitochondria.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIAA0664 (1 products)

Catalog No. Species Pres. Purity   Source  

KIAA0664

KIAA0664 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for KIAA0664 (1 products)

Catalog No. Species Pres. Purity   Source  

CLUH overexpression lysate

CLUH overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn