TA337379 KIAA0748 antibody

Rabbit Polyclonal Anti-TESPA1 Antibody

See related secondary antibodies

Search for all "KIAA0748"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Porcine, Rabbit KIAA0748

Product Description for KIAA0748

Rabbit anti Canine, Equine, Human, Porcine, Rabbit KIAA0748.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA0748

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Can, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A2RU30
Immunogen:
The immunogen for Anti-TESPA1 antibody is: synthetic peptide directed towards the C-terminal region of Human TESPA1. Synthetic peptide located within the following region: SLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLF.
GeneID:
9840
Application WB
Background TESPA1 is required for the development and maturation of T-cells, its function being essential for the late stages of thymocyte development. It plays a role in T-cell antigen receptor (TCR)-mediated activation of the ERK and NFAT sigling pathways, possibly by serving as a scaffolding protein that promotes the assembly of the LAT siglosome in thymocytes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIAA0748 (2 products)

Catalog No. Species Pres. Purity   Source  

KIAA0748

KIAA0748 Human Purified
  Abnova Taiwan Corp.

KIAA0748

KIAA0748 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn