TA337393 KIAA2013 antibody

Rabbit Polyclonal Anti-KIAA2013 Antibody

See related secondary antibodies

Search for all "KIAA2013"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KIAA2013

Product Description for KIAA2013

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KIAA2013.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA2013

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYS2
Immunogen:
The immunogen for Anti-KIAA2013 antibody is: synthetic peptide directed towards the C-terminal region of Human KIAA2013. Synthetic peptide located within the following region: TDTHTPSGLTVNLTLYYMLSCSPAPLLSPSLSHRERDQMESTLNYEDHCF.
GeneID:
90231
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KIAA2013 (1 products)

Catalog No. Species Pres. Purity   Source  

KIAA2013 overexpression lysate

KIAA2013 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn