TA337396 KLHL33 antibody

Rabbit Polyclonal Anti-KLHL33 Antibody

See related secondary antibodies

Search for all "KLHL33"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KLHL33

Product Description for KLHL33

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KLHL33.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KLHL33

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Kelch-like protein 33
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NCF5
Immunogen:
The immunogen for Anti-KLHL33 antibody is: synthetic peptide directed towards the N-terminal region of Human KLHL33. Synthetic peptide located within the following region: VRFGRMSTRELRRVRAAGLLPPLTPDLLHQLMVEADVPGQERRREPDRAL.
GeneID:
123103
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn