TA337400 Cytokeratin 78 / KRT78 antibody

Rabbit Polyclonal Anti-KRT78 Antibody

See related secondary antibodies

Search for all "Cytokeratin 78 / KRT78"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep Cytokeratin 78 / KRT78

Product Description for Cytokeratin 78 / KRT78

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep Cytokeratin 78 / KRT78.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cytokeratin 78 / KRT78

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CK-78, K5B, K78, KB40, Keratin, Keratin-5b, Keratin-78, Type-II keratin Kb40, type II cytoskeletal 78
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N1N4
Immunogen:
The immunogen for Anti-KRT78 antibody is: synthetic peptide directed towards the middle region of Human KRT78. Synthetic peptide located within the following region: TQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTK.
GeneID:
196374
Application WB
Background This gene is a member of the type II keratin gene family and encodes a protein with an intermediate filament domain. Keratins are the major structural proteins in epithelial cells, forming a cytoplasmic network of 10 to 12 nm wide intermediate filaments and creating a scaffold that gives cells the ability to withstand mechanical and non-mechanical stresses. The genes of the type II keratin family are located as a gene cluster at 12p13.13. Four pseudogenes of this gene family have been identified.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Cytokeratin 78 / KRT78 (1 products)

Catalog No. Species Pres. Purity   Source  

KRT78 overexpression lysate

KRT78 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn