TA337415 LRP5L antibody

Rabbit Polyclonal Anti-LRP5L Antibody

See related secondary antibodies

Search for all "LRP5L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat LRP5L

Product Description for LRP5L

Rabbit anti Human, Rat LRP5L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRP5L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Low-density lipoprotein receptor-related protein 5-like protein
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4QPB2
Immunogen:
The immunogen for Anti-LRP5L antibody is: synthetic peptide directed towards the C-terminal region of Human LRP5L. Synthetic peptide located within the following region: AKTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRV.
GeneID:
91355
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LRP5L (2 products)

Catalog No. Species Pres. Purity   Source  

LRP5L (transcript variant 1)

LRP5L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LRP5L (full length, N-term HIS tag, transcript variant 2)

LRP5L Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for LRP5L (2 products)

Catalog No. Species Pres. Purity   Source  

LRP5L overexpression lysate

LRP5L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

LRP5L overexpression lysate

LRP5L overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn