TA337426 MAPK1IP1L antibody

Rabbit Polyclonal Anti-MAPK1IP1L Antibody

See related secondary antibodies

Search for all "MAPK1IP1L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine MAPK1IP1L

Product Description for MAPK1IP1L

Rabbit anti Bovine, Canine, Equine, Human, Porcine MAPK1IP1L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MAPK1IP1L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C14orf32, MAPK-interacting and spindle-stabilizing protein-like, Mitogen-activated protein kinase 1-interacting protein 1-like
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NDC0
Immunogen:
The immunogen for Anti-MAPK1IP1L antibody is: synthetic peptide directed towards the N-terminal region of Human MAPK1IP1L. Synthetic peptide located within the following region: SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPS.
GeneID:
93487
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for MAPK1IP1L (2 products)

Catalog No. Species Pres. Purity   Source  

MAPK1IP1L Lysate

Western Blot: MAPK1IP1L Lysate [NBL1-12876] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MAPK1IP1L
  Novus Biologicals Inc.

MAPK1IP1L overexpression lysate

MAPK1IP1L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn