TA337554 RAB3IP antibody

Rabbit Polyclonal Anti-RAB3IP Antibody

See related secondary antibodies

Search for all "RAB3IP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RAB3IP

TA337554

More Views

  • TA337554

Product Description for RAB3IP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RAB3IP.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for RAB3IP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RABIN3, Rab-3A-interacting protein, Rabin-3, SSX2-interacting protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96QF0
Immunogen:
The immunogen for anti-RAB3IP antibody: synthetic peptide directed towards the N terminal of human RAB3IP. Synthetic peptide located within the following region: APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD.
GeneID:
117177
Application WB
IF
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB3IP (6 products)

Catalog No. Species Pres. Purity   Source  

RAB3IP

RAB3IP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RAB3IP (full length, N-term HIS tag, transcript variant A)

RAB3IP Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

RAB3IP

RAB3IP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RAB3IP

RAB3IP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RAB3IP

RAB3IP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB3IP

RAB3IP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RAB3IP (5 products)

Catalog No. Species Pres. Purity   Source  

RAB3IP 293T Cell Transient Overexpression Lysate(Denatured)

RAB3IP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RAB3IP Lysate

Western Blot: RAB3IP Lysate [NBL1-15075] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAB3IP
  Novus Biologicals Inc.

RAB3IP overexpression lysate

RAB3IP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RAB3IP overexpression lysate

RAB3IP overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

RAB3IP overexpression lysate

RAB3IP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn