TA337555 Synaptotagmin-9 antibody

Rabbit Polyclonal Anti-SYT9 Antibody

See related secondary antibodies

Search for all "Synaptotagmin-9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Synaptotagmin-9

TA337555

More Views

  • TA337555
  • TA337555

Product Description for Synaptotagmin-9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Synaptotagmin-9.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for Synaptotagmin-9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SYT-9, SYT9, Synaptotagmin 9, Synaptotagmin IX, SytIX
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86SS6
Immunogen:
The immunogen for anti-SYT9 antibody: synthetic peptide directed towards the middle region of human SYT9. Synthetic peptide located within the following region: PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL.
GeneID:
143425
Application WB
IF
Background SYT9 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Synaptotagmin-9 (1 products)

Catalog No. Species Pres. Purity   Source  

Synaptotagmin-9

Synaptotagmin-9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Synaptotagmin-9 (2 products)

Catalog No. Species Pres. Purity   Source  

SYT9 Lysate

Western Blot: SYT9 Lysate [NBL1-16656] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SYT9
  Novus Biologicals Inc.

SYT9 overexpression lysate

SYT9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn