TA337557 Beta-klotho / KLB antibody

Rabbit Polyclonal Anti-KLB Antibody

See related secondary antibodies

Search for all "Beta-klotho / KLB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Beta-klotho / KLB

TA337557

More Views

  • TA337557
  • TA337557

Product Description for Beta-klotho / KLB

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Beta-klotho / KLB.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Beta-klotho / KLB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BKL, Klotho beta-like protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86Z14
Immunogen:
The immunogen for anti-KLB antibody: synthetic peptide directed towards the middle region of human KLB. Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG.
GeneID:
152831
Application WB
IHC
Background KLB is a single-pass type III membrane protein. It contributes to the transcriptiol repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably ictive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn