TA337563 DHFRL1 / DHFRP4 antibody

Rabbit Polyclonal Anti-DHFRL1 Antibody

See related secondary antibodies

Search for all "DHFRL1 / DHFRP4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHFRL1 / DHFRP4

Product Description for DHFRL1 / DHFRP4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHFRL1 / DHFRP4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DHFRL1 / DHFRP4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Dihydrofolate reductase-like protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86XF0
Immunogen:
The immunogen for anti-DHFRL1 antibody: synthetic peptide directed towards the middle region of human DHFRL1. Synthetic peptide located within the following region: RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS.
GeneID:
200895
Application WB
Background DHFRL1 may play a role in folate metabolism.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DHFRL1 / DHFRP4 (3 products)

Catalog No. Species Pres. Purity   Source  

DHFRL1 / DHFRP4

DHFRL1 / DHFRP4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DHFRL1 / DHFRP4

DHFRL1 / DHFRP4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DHFRL1 / DHFRP4

DHFRL1 / DHFRP4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DHFRL1 / DHFRP4 (2 products)

Catalog No. Species Pres. Purity   Source  

DHFRL1 293T Cell Transient Overexpression Lysate(Denatured)

DHFRL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DHFRL1 Lysate

Western Blot: DHFRL1 Lysate [NBL1-09861] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DHFRL1
  Novus Biologicals Inc.
  • LinkedIn