TA337569 ASB6 antibody

Rabbit Polyclonal Anti-ASB6 Antibody

See related secondary antibodies

Search for all "ASB6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Porcine, Rat, Zebrafish, African clawed frog ASB6

Product Description for ASB6

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Porcine, Rat, Zebrafish, African clawed frog ASB6.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ASB6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ASB-6, Ankyrin repeat and SOCS box protein 6
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NWX5
Immunogen:
Synthetic peptide directed towards the middle region of human ASB6
AA Sequence:
LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV
GeneID:
140459
Application Western blotting (0.2 - 1 µg/ml)
Background ASB6 belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.
General Readings "ASB proteins interact with cullin5 and Rbx2 to form E3 ubiquitin ligase complexes." Kohroki J., Nishiyama T., Nakamura T., Masuho Y. FEBS Lett. 579:6796-6802(2005)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Rabbit, Pig, Chicken, Dog, Bovine, Horse, Xenopus, Zebrafish
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ASB6 (3 products)

Catalog No. Species Pres. Purity   Source  

ASB6 (transcript variant 1)

ASB6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ASB6

ASB6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ASB6

ASB6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ASB6 (4 products)

Catalog No. Species Pres. Purity   Source  

ASB6 Lysate(Denatured)

ASB6 Lysate(Denatured)
  Abnova Taiwan Corp.

ASB6 Lysate(Denatured)

ASB6 Lysate(Denatured)
  Abnova Taiwan Corp.

ASB6 Lysate

Western Blot: ASB6 Lysate [NBL1-07753] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ASB6 Protein
  Novus Biologicals Inc.

ASB6 overexpression lysate

ASB6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn