TA337583 CMTM8 antibody

Rabbit Polyclonal Anti-CMTM8 Antibody

See related secondary antibodies

Search for all "CMTM8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CMTM8

Product Description for CMTM8

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CMTM8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CMTM8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CKLF-like MARVEL transmembrane domain-containing protein 8, CKLFSF8, Chemokine-like factor superfamily member 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IZV2
Immunogen:
The immunogen for anti-CMTM8 antibody: synthetic peptide directed towards the middle region of human CMTM8. Synthetic peptide located within the following region: CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN.
GeneID:
152189
Application WB
Background Cmtm8 gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CMTM8 (6 products)

Catalog No. Species Pres. Purity   Source  

CMTM8

CMTM8 Human
  Abnova Taiwan Corp.

CMTM8

CMTM8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CMTM8

CMTM8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CMTM8

CMTM8 Human Purified
  Abnova Taiwan Corp.

CMTM8

CMTM8 Human
  Abnova Taiwan Corp.

CMTM8

CMTM8 Human Purified
  Abnova Taiwan Corp.

Positive controls for CMTM8 (1 products)

Catalog No. Species Pres. Purity   Source  

CMTM8 overexpression lysate

CMTM8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn