TA337589 UBXN2A / UBXD4 antibody

Rabbit Polyclonal Anti-Ubxn2a Antibody

See related secondary antibodies

Search for all "UBXN2A / UBXD4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat UBXN2A / UBXD4

Product Description for UBXN2A / UBXD4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat UBXN2A / UBXD4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UBXN2A / UBXD4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UBX domain-containing protein 2A, UBX domain-containing protein 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99KJ0
Immunogen:
The immunogen for anti-Ubxn2a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE.
GeneID:
217379
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn