TA337591 AASDH antibody

Rabbit Polyclonal Anti-AASDH Antibody

See related secondary antibodies

Search for all "AASDH"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat AASDH

Product Description for AASDH

Rabbit anti Human, Mouse, Rat AASDH.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for AASDH

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ACSF4, Acyl-CoA synthetase family member 4, HSPC318, U26
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4L235
Immunogen:
Synthetic peptide directed towards the middle region of human AASDH
AA Sequence:
TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL
GeneID:
132949
Application

Western blotting  (0.2 -1 µg/ml).

Background Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.
General Readings Watkins,P.A., (2007) J. Lipid Res. 48 (12), 2736-2750
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Dog, Horse, Bovine
Species reactivity (tested):
Human, Mouse, Rat

Accessory Products

Proteins and/or Positive Controls

Proteins for AASDH (2 products)

Catalog No. Species Pres. Purity   Source  

AASDH

AASDH Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AASDH

AASDH Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for AASDH (1 products)

Catalog No. Species Pres. Purity   Source  

AASDH 293T Cell Transient Overexpression Lysate(Denatured)

AASDH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn