TA337593 CCDC38 antibody

Rabbit Polyclonal Anti-CCDC38 Antibody

See related secondary antibodies

Search for all "CCDC38"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CCDC38

Product Description for CCDC38

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CCDC38.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC38

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Coiled-coil domain-containing protein 38
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q502W7
Immunogen:
The immunogen for anti-CCDC38 antibody: synthetic peptide directed towards the N terminal of human CCDC38. Synthetic peptide located within the following region: RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE.
GeneID:
120935
Application WB
Background The specific function of CCDC38 is not yet known.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CCDC38 (2 products)

Catalog No. Species Pres. Purity   Source  

CCDC38

CCDC38 Human Purified
  Abnova Taiwan Corp.

CCDC38

CCDC38 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn