TA337600 PRELID2 antibody

Rabbit Polyclonal Anti-PRELID2 Antibody

See related secondary antibodies

Search for all "PRELID2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PRELID2

Product Description for PRELID2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PRELID2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRELID2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLJ38376, PRELI domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N945
Immunogen:
The immunogen for anti-PRELID2 antibody: synthetic peptide directed towards the C terminal of human PRELID2. Synthetic peptide located within the following region: GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE.
GeneID:
153768
Application WB
Background PRELID2 contains 1 PRELI/MSF1 domain. The exact function of PRELID2 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PRELID2 (2 products)

Catalog No. Species Pres. Purity   Source  

PRELID2 (full length, N-term HIS tag, transcript variant 3)

PRELID2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

PRELID2 (full length, N-term HIS tag)

PRELID2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for PRELID2 (2 products)

Catalog No. Species Pres. Purity   Source  

PRELID2 Lysate

Western Blot: PRELID2 Lysate [NBL1-14746] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PRELID2
  Novus Biologicals Inc.

PRELID2 overexpression lysate

PRELID2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn