TA337610 ASB7 antibody

Rabbit Polyclonal Anti-ASB7 Antibody

See related secondary antibodies

Search for all "ASB7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ASB7

Product Description for ASB7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ASB7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ASB7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ASB-7, Ankyrin repeat and SOCS box protein 7
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H672
Immunogen:
The immunogen for anti-ASB7 antibody: synthetic peptide directed towards the middle region of human ASB7. Synthetic peptide located within the following region: QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC.
GeneID:
140460
Application WB
Background The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-termil SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquition and, therefore, for proteasome-mediated degradation. Two altertive transcripts encoding different isoforms have been described.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ASB7 (5 products)

Catalog No. Species Pres. Purity   Source  

ASB7 (transcript variant 1)

ASB7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ASB7

ASB7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASB7

ASB7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASB7

ASB7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ASB7

ASB7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ASB7 (2 products)

Catalog No. Species Pres. Purity   Source  

ASB7 Lysate(Denatured)

ASB7 Lysate(Denatured)
  Abnova Taiwan Corp.

ASB7 Lysate

Western Blot: ASB7 Lysate [NBL1-07754] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ASB7 Protein
  Novus Biologicals Inc.
  • LinkedIn