TA337613 DENND2C antibody

Rabbit Polyclonal Anti-DENND2C Antibody

See related secondary antibodies

Search for all "DENND2C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DENND2C

Product Description for DENND2C

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DENND2C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DENND2C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DENN domain-containing protein 2C
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68D51
Immunogen:
The immunogen for anti-DENND2C antibody: synthetic peptide directed towards the middle region of human DENND2C. Synthetic peptide located within the following region: DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL.
GeneID:
163259
Application WB
Background The specific function of DENND2C is not yet known.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for DENND2C (1 products)

Catalog No. Species Pres. Purity   Source  

DENND2C overexpression lysate

DENND2C overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn