TA337615 DHRS9 antibody

Rabbit Polyclonal Anti-DHRS9 Antibody

See related secondary antibodies

Search for all "DHRS9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat DHRS9

Product Description for DHRS9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat DHRS9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DHRS9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-alpha hydroxysteroid dehydrogenase, Dehydrogenase/reductase SDR family member 9, NADP-dependent retinol dehydrogenase/reductase, RDH-E2, RDHL, Short-chain dehydrogenase/reductase retSDR8, retSDR8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BPW9
Immunogen:
The immunogen for anti-DHRS9 antibody: synthetic peptide directed towards the middle region of human DHRS9. Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV.
GeneID:
10170
Application WB
Background This gene encodes a member of the short-chain dehydrogeses/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additiolly function as a transcriptiol repressor in the nucleus. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DHRS9 (6 products)

Catalog No. Species Pres. Purity   Source  

DHRS9 (transcript variant 2)

DHRS9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DHRS9 (transcript variant 3)

DHRS9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DHRS9 (transcript variant 4)

DHRS9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DHRS9 (18-319, His-tag)

DHRS9 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

DHRS9 (18-319, His-tag)

DHRS9 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

DHRS9

DHRS9 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DHRS9 (5 products)

Catalog No. Species Pres. Purity   Source  

DHRS9 293T Cell Transient Overexpression Lysate(Denatured)

DHRS9 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DHRS9 Lysate

Western Blot: DHRS9 Lysate [NBL1-09873] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DHRS9
  Novus Biologicals Inc.

DHRS9 overexpression lysate

DHRS9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DHRS9 overexpression lysate

DHRS9 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

DHRS9 overexpression lysate

DHRS9 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn