TA337632 OSCP1 antibody

Rabbit Polyclonal Anti-OSCP1 Antibody

See related secondary antibodies

Search for all "OSCP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish OSCP1

Product Description for OSCP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish OSCP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OSCP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C1orf102, NOR1, Organic solute transport protein 1, Oxidored-nitro domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVF1
Immunogen:
The immunogen for anti-OSCP1 antibody: synthetic peptide directed towards the N terminal of human OSCP1. Synthetic peptide located within the following region: ARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQ.
GeneID:
127700
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OSCP1 (1 products)

Catalog No. Species Pres. Purity   Source  

OSCP1 (transcript variant 1)

OSCP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for OSCP1 (1 products)

Catalog No. Species Pres. Purity   Source  

OSCP1 overexpression lysate

OSCP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn