TA337640 ZSWIM3 antibody

Rabbit Polyclonal Anti-ZSWIM3 Antibody

See related secondary antibodies

Search for all "ZSWIM3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZSWIM3

Product Description for ZSWIM3

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZSWIM3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZSWIM3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf164, Zinc finger SWIM domain-containing protein 3
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MP5
Immunogen:
The immunogen for anti-ZSWIM3 antibody: synthetic peptide directed towards the N terminal of human ZSWIM3. Synthetic peptide located within the following region: SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY.
GeneID:
140831
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZSWIM3 (1 products)

Catalog No. Species Pres. Purity   Source  

ZSWIM3

ZSWIM3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ZSWIM3 (1 products)

Catalog No. Species Pres. Purity   Source  

ZSWIM3 Lysate

Western Blot: ZSWIM3 Lysate [NBL1-18275] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZSWIM3
  Novus Biologicals Inc.
  • LinkedIn