TA337645 PLA2G4E antibody

Rabbit Polyclonal Anti-PLA2G4E Antibody

See related secondary antibodies

Search for all "PLA2G4E"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PLA2G4E

Product Description for PLA2G4E

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PLA2G4E.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PLA2G4E

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cytosolic phospholipase A2 epsilon, Phospholipase A2 group IVE, cPLA2-epsilon
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3MJ16
Immunogen:
The immunogen for anti-PLA2G4E antibody: synthetic peptide directed towards the c terminal of human PLA2G4E. Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT.
GeneID:
123745
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn