TA337662 Matrilin-3 antibody

Rabbit Polyclonal Anti-MATN3 Antibody

See related secondary antibodies

Search for all "Matrilin-3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Matrilin-3

Product Description for Matrilin-3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Matrilin-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Matrilin-3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MATN3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15232
Immunogen:
The immunogen for anti-MATN3 antibody: synthetic peptide directed towards the middle region of human MATN3. Synthetic peptide located within the following region: IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA.
GeneID:
4148
Application WB
Background This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains two von Willebrand factor A domains; it is present in the cartilage extracellular matrix and has a role in the development and homeostasis of cartilage and bone. Mutations in this gene result in multiple epiphyseal dysplasia. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Matrilin-3 (1 products)

Catalog No. Species Pres. Purity   Source  

Matrilin-3

Matrilin-3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Matrilin-3 (1 products)

Catalog No. Species Pres. Purity   Source  

MATN3 overexpression lysate

MATN3 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn