TA337676 PCOLCE antibody

Rabbit Polyclonal Anti-PCOLCE Antibody

See related secondary antibodies

Search for all "PCOLCE"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PCOLCE

Product Description for PCOLCE

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PCOLCE.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PCOLCE

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PCPE-1, PCPE1, Procollagen C-endopeptidase enhancer 1, Procollagen C-proteinase enhancer 1, Procollagen COOH-terminal proteinase enhancer 1, Type 1 procollagen C-proteinase enhancer protein, Type I procollagen COOH-terminal proteinase enhancer
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15113
Immunogen:
The immunogen for anti-PCOLCE antibody: synthetic peptide directed towards the middle region of human PCOLCE. Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS.
GeneID:
5118
Application WB
Background PCOLCE binds to the C-termil propeptide of type I procollagen and enhances procollagen C-proteise activity.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PCOLCE (5 products)

Catalog No. Species Pres. Purity   Source  

PCOLCE

PCOLCE Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PCOLCE (26-449, His-tag)

PCOLCE Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

PCOLCE (26-449, His-tag)

PCOLCE Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

PCOLCE

PCOLCE Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

PCOLCE

PCOLCE Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for PCOLCE (3 products)

Catalog No. Species Pres. Purity   Source  

PCOLCE 293T Cell Transient Overexpression Lysate(Denatured)

PCOLCE 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PCOLCE Lysate

Western Blot: PCOLCE Lysate [NBL1-14186] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PCOLCE
  Novus Biologicals Inc.

PCOLCE overexpression lysate

PCOLCE overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn