TA337677 Properdin antibody

Rabbit Polyclonal Anti-CFP Antibody

See related secondary antibodies

Search for all "Properdin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Properdin

Product Description for Properdin

Rabbit anti Human Properdin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Properdin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CFP, Complement factor P, PFC
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P27918
Immunogen:
The immunogen for anti-CFP antibody: synthetic peptide directed towards the N terminal of human CFP. Synthetic peptide located within the following region: QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS.
GeneID:
5199
Application WB
Background CFP is a plasma glycoprotein that positively regulates the altertive complement pathway of the inte immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedbac
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Properdin (11 products)

Catalog No. Species Pres. Purity   Source  

Properdin (28-469, His-tag)

Properdin Human Purified > 80 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Properdin (28-469, His-tag)

Properdin Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Properdin

Properdin Human
  Abnova Taiwan Corp.

Properdin

Properdin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Properdin

Properdin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Properdin

Properdin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Properdin

Properdin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Properdistatin

Properdistatin > 95 % by HPLC
5.0 mg / €550.00
  OriGene Technologies GmbH

Properdistatin

Properdistatin > 95 % by HPLC
1.0 mg / €230.00
  OriGene Technologies GmbH

Properdistatin

Properdistatin > 95 % by HPLC
0.5 mg / €170.00
  OriGene Technologies GmbH

Properdistatin

Properdistatin > 95 % by HPLC
0.1 mg / €100.00
  OriGene Technologies GmbH

Positive controls for Properdin (4 products)

Catalog No. Species Pres. Purity   Source  

CFP 293T Cell Transient Overexpression Lysate(Denatured)

CFP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CFP overexpression lysate

CFP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CFP overexpression lysate

CFP overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

Properdin Lysate

Western Blot: Properdin Lysate [NBL1-09129] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CFP
  Novus Biologicals Inc.
  • LinkedIn