TA337748 Otopetrin-1 antibody

Rabbit Polyclonal Anti-OTOP1 Antibody

See related secondary antibodies

Search for all "Otopetrin-1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Otopetrin-1

Product Description for Otopetrin-1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Otopetrin-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Otopetrin-1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OTOP1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7RTM1
Immunogen:
The immunogen for anti-OTOP1 antibody is: synthetic peptide directed towards the C-terminal region of Human OTOP1. Synthetic peptide located within the following region: KTKSESALIMFYLYAITLLMLMGAAGLAGIRIYRIDEKSLDESKNPARKL.
GeneID:
133060
Application WB
Background OTOP1 is required for normal formation of otoconia in the inner ear. OTOP1 inhibits P2Y purinoceptors and modulates calcium homeostasis and influx of calcium in response to extracellular ATP.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Otopetrin-1 (2 products)

Catalog No. Species Pres. Purity   Source  

Otopetrin-1

Otopetrin-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Otopetrin-1

Otopetrin-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn