TA337768 Mimitin antibody

Rabbit Polyclonal Anti-NDUFAF2 Antibody

See related secondary antibodies

Search for all "Mimitin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit Mimitin

Product Description for Mimitin

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit Mimitin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Mimitin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms B17.2-like, Myc-induced mitochondrial protein, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2, NDUFA12L, NDUFAF2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N183
Immunogen:
The immunogen for anti-NDUFAF2 antibody is: synthetic peptide directed towards the N-terminal region of Human NDUFAF2. Synthetic peptide located within the following region: HVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEW.
GeneID:
91942
Application WB
Background DH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from DH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Mimitin (4 products)

Catalog No. Species Pres. Purity   Source  

Mimitin

Mimitin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Mimitin (1-169, His-tag)

Mimitin Human Purified > 85 % E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

Mimitin (1-169, His-tag)

Mimitin Human Purified > 85 % E. coli
50 µg / €400.00
  OriGene Technologies GmbH

Mimitin

Mimitin Human
  Abnova Taiwan Corp.

Positive controls for Mimitin (1 products)

Catalog No. Species Pres. Purity   Source  

NDUFAF2 overexpression lysate

NDUFAF2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn