TA337769 ZCCHC12 antibody

Rabbit Polyclonal Anti-ZCCHC12 Antibody

See related secondary antibodies

Search for all "ZCCHC12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZCCHC12

Product Description for ZCCHC12

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZCCHC12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZCCHC12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SIZN1, Zinc finger CCHC domain-containing protein 12
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PEW1
Immunogen:
The immunogen for anti-ZCCHC12 antibody: synthetic peptide directed towards the N terminal of human ZCCHC12. Synthetic peptide located within the following region: AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE.
GeneID:
170261
Application WB
Background ZCCHC12 contains 1 CCHC-type zinc finger. ZCCHC12 is the transcriptiol coactivator in the bone morphogenetic protein (BMP)-sigling pathway. It positively modulates BMP sigling by interacting with SMAD1 and associating with CBP in the transcription complex. It contributes to the BMP-induced enhancement of cholinergic-neuron-specific gene expression.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZCCHC12 (4 products)

Catalog No. Species Pres. Purity   Source  

ZCCHC12 (1-402, His-tag)

ZCCHC12 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ZCCHC12 (1-402, His-tag)

ZCCHC12 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

ZCCHC12

ZCCHC12 Human Purified
  Abnova Taiwan Corp.

ZCCHC12

ZCCHC12 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZCCHC12 (2 products)

Catalog No. Species Pres. Purity   Source  

ZCCHC12 293T Cell Transient Overexpression Lysate(Denatured)

ZCCHC12 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZCCHC12 Lysate

Western Blot: ZCCHC12 Lysate [NBL1-17989] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZCCHC12
  Novus Biologicals Inc.
  • LinkedIn