TA337823 C12orf53 antibody

Rabbit Polyclonal Anti-PIANP Antibody

See related secondary antibodies

Search for all "C12orf53"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C12orf53

Product Description for C12orf53

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C12orf53.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C12orf53

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C12orf53
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYJ0
Immunogen:
The immunogen for anti-PIANPantibody: synthetic peptide directed towards the middle region of human C12orf53. Synthetic peptide located within the following region: VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI.
GeneID:
196500
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C12orf53 (1 products)

Catalog No. Species Pres. Purity   Source  

PIANP overexpression lysate

PIANP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn