TA337850 RPESP antibody

Rabbit Polyclonal Anti-SBSPON Antibody

See related secondary antibodies

Search for all "RPESP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RPESP

Product Description for RPESP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RPESP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPESP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C8orf84, RPE-spondin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVN8
Immunogen:
The immunogen for anti-SBSPON antibody: synthetic peptide directed towards the C terminal of human SBSPON. Synthetic peptide located within the following region: WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC.
GeneID:
157869
Application WB
Background SBSPON belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of SBSPON remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for RPESP (1 products)

Catalog No. Species Pres. Purity   Source  

SBSPON overexpression lysate

SBSPON overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn