TA337873 KHDRBS2 antibody

Rabbit Polyclonal Anti-KHDRBS2 Antibody

See related secondary antibodies

Search for all "KHDRBS2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KHDRBS2

Product Description for KHDRBS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KHDRBS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KHDRBS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KH domain-containing, KHDRBS2, RNA-binding, SLM-1, SLM1, Sam68-like mammalian protein 1, hSLM-1, signal transduction-associated protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VWX1
Immunogen:
The immunogen for anti-KHDRBS2 antibody: synthetic peptide directed towards the N terminal of human KHDRBS2. Synthetic peptide located within the following region: EEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGK.
GeneID:
202559
Application WB
Background KHDRBS2 is a R-binding protein that plays a role in the regulation of altertive splicing and influences mR splice site selection and exon inclusion. Its phosphorylation by FYN inhibits its ability to regulate splice site selection. KHDRBS2 induces an increased concentration-dependent incorporation of exon in CD44 pre-mR by direct binding to purine-rich exonic enhancer. KHDRBS2 may function as an adapter protein for Src kises during mitosis. KHDRBS2 binds both poly(A) and poly(U) homopolymers. Phosphorylation by PTK6 inhibits its R-binding ability.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KHDRBS2 (3 products)

Catalog No. Species Pres. Purity   Source  

KHDRBS2

KHDRBS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KHDRBS2

KHDRBS2 Human Purified
  Abnova Taiwan Corp.

KHDRBS2

KHDRBS2 Human Purified
  Abnova Taiwan Corp.

Positive controls for KHDRBS2 (3 products)

Catalog No. Species Pres. Purity   Source  

KHDRBS2 293T Cell Transient Overexpression Lysate(Denatured)

KHDRBS2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

KHDRBS2 Lysate

Western Blot: KHDRBS2 Lysate [NBL1-12230] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KHDRBS2
  Novus Biologicals Inc.

KHDRBS2 overexpression lysate

KHDRBS2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn