TA337882 ORAI3 antibody

Rabbit Polyclonal Anti-ORAI3 Antibody

See related secondary antibodies

Search for all "ORAI3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ORAI3

Product Description for ORAI3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ORAI3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ORAI3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ORAI-3, TMEM142C, Transmembrane Protein 142C
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BRQ5
Immunogen:
The immunogen for anti-ORAI3 antibody is: synthetic peptide directed towards the N-terminal region of Human ORAI3. Synthetic peptide located within the following region: GDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLY.
GeneID:
93129
Application WB
Background ORAI3 is a key regulator or component of store-operated Ca2+ channel and transcription factor NFAT nuclear import.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn